PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10017119m
Common NameCARUB_v10017119mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 484aa    MW: 54322.7 Da    PI: 6.337
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10017119mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.11e-133579348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      WT+eEd++l + +  +G+++W+ Ia+++   ++  qc+ rw++yl
  Carubv10017119m 35 TWTPEEDDILRKHISVHGTENWAIIASKFT-DKSTRQCRRRWYTYL 79
                     6****************************9.*************97 PP

2Myb_DNA-binding44.73.1e-1485128146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg W++eEd ll +a +++G++ W+ Ia+ +  gRt++ +k+r+ +
  Carubv10017119m  85 RGGWSPEEDTLLCEAQRLFGNR-WTEIAKVVS-GRTDNAVKNRFTT 128
                      789*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.9532879IPR017930Myb domain
SuperFamilySSF466895.99E-2632126IPR009057Homeodomain-like
SMARTSM007173.0E-133281IPR001005SANT/Myb domain
CDDcd001675.80E-133579No hitNo description
Gene3DG3DSA:1.10.10.606.8E-213687IPR009057Homeodomain-like
PfamPF139213.6E-163696No hitNo description
PROSITE profilePS5129420.81280134IPR017930Myb domain
SMARTSM007178.4E-1584132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-1988133IPR009057Homeodomain-like
CDDcd001677.99E-1188129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MEETTKQNNN TNSNKKKKVV VNTDDSKKKE RHIVTWTPEE DDILRKHISV HGTENWAIIA  60
SKFTDKSTRQ CRRRWYTYLN SDFKRGGWSP EEDTLLCEAQ RLFGNRWTEI AKVVSGRTDN  120
AVKNRFTTLC KKRAKYEAMA KENSIGCCVN SNNKRLLFPD GISTPRKAES ESPLTKKMRK  180
SHIPNLTEIK SYGDRSHIKV ESAMNQQSRP PFSVVAHNAT GIDGTKEQKQ TGNAKESDGG  240
DKGTQEVFLK KDDSKVTALM QQVELLSSLA QKVNADDTDQ SMDNAWKVLQ DYLNKSKEND  300
LFRYGIPDID FQLEEFKDLV EDLRSSNEDS QTSWRQPDLH DSPASSEYSS GSTVMQHSSG  360
DKTQQPMSDT QTTLQKQDEG ELLQAKGIVS DATVEQVDLL TTCQDVLKNP NEIVPMTCDE  420
EFNSPVQVTP LFRSLAAGIP SPQFSESERS FLLKTLGVES PCPCPSANPS QPPPCKRVLL  480
DSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-243613410108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2265750.0AK226575.1 Arabidopsis thaliana mRNA for hypothetical protein, clone: RAFL07-13-I18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006291006.10.0hypothetical protein CARUB_v10017119mg
TrEMBLR0H3R40.0R0H3R4_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.5__181__AT2G02820.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33742863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.20.0myb domain protein 88